PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01601.1.p
Common NameEUGRSUZ_J01601, LOC104422165
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 322aa    MW: 35525.6 Da    PI: 4.9831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01601.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l++ +  +G  +W+++++  g+ R++k+c++rw +yl
  Eucgr.J01601.1.p 14 KGPWTAEEDKKLINFILTHGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding56.37.2e-1870111447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +++E++l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  Eucgr.J01601.1.p  70 LSEQEEKLVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                       589****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.257961IPR017930Myb domain
SuperFamilySSF466896.36E-2811108IPR009057Homeodomain-like
SMARTSM007171.6E-131363IPR001005SANT/Myb domain
PfamPF002492.3E-151461IPR001005SANT/Myb domain
CDDcd001672.69E-101661No hitNo description
PROSITE profilePS5129427.39362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2564117IPR009057Homeodomain-like
SMARTSM007172.7E-1666114IPR001005SANT/Myb domain
PfamPF002499.2E-1670111IPR001005SANT/Myb domain
CDDcd001671.21E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTAE EDKKLINFIL THGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEQEEKLVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
VDPVTHKPLV SNPSDPPQSL QNHHQQKEEQ SCSTSSADAA KTPSADNFID SVLTEAKEEE  180
DGTSCMANAS LLETIEVMDM NSFCTDEVPL IDPSDILVAC PPSSSISSSS SSYNNGGGGG  240
GGGNFIQELQ FPDLDWSYGE FGNSGDGDNQ HSKPWDDDDF INWDFLVGSV DDKTLMLDPH  300
PVNSCQRSAL DQSSWTNELV Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01601.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032717.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-86ODO1_PETHY; Protein ODORANT1
TrEMBLA0A059ADJ00.0A0A059ADJ0_EUCGR; Uncharacterized protein
STRINGPOPTR_0017s02850.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.11e-90myb domain protein 43